The Programmable Tree Drawing Engine

Overview

ETE’s treeview extension provides a highly programmable drawing system to render any hierarchical tree structure as PDF, SVG or PNG images. Although several predefined visualization layouts are included with the default installation, custom styles can be easily created from scratch.

Image customization is performed through four elements: a) TreeStyle, setting general options about the image (shape, rotation, etc.), b) NodeStyle, which defines the specific aspect of each node (size, color, background, line type, etc.), c) node faces.Face which are small pieces of extra graphical information that can be added to nodes (text labels, images, graphs, etc.) d) a layout function, a normal python function that controls how node styles and faces are dynamically added to nodes.

Images can be rendered as PNG, PDF or SVG files using the TreeNode.render() method or interactively visualized using a built-in Graphical User Interface (GUI) invoked by the TreeNode.show() method.

Interactive visualization of trees

ETE’s tree drawing engine is fully integrated with a built-in graphical user interface (GUI). Thus, ETE allows to visualize trees using an interactive interface that allows to explore and manipulate node’s properties and tree topology. To start the visualization of a node (tree or subtree), you can simply call the TreeNode.show() method.

One of the advantages of this on-line GUI visualization is that you can use it to interrupt a given program/analysis, explore the tree, manipulate them, and continuing with the execution thread. Note that changes made using the GUI will be kept after quiting the GUI. This feature is specially useful for using during python sessions, in which analyses are performed interactively.

The GUI allows many operations to be performed graphically, however it does not implement all the possibilities of the programming toolkit.

from ete3 import Tree
t = Tree( "((a,b),c);" )
t.show()

Rendering trees as images

Tree images can be directly written as image files. SVG, PDF and PNG formats are supported. Note that, while PNG images are raster images, PDF and SVG pictures are rendered as vector graphics, thus allowing its later modification and scaling.

To generate an image, the TreeNode.render() method should be used instead of TreeNode.show(). The only required argument is the file name, whose extension will determine the image format (.PDF, .SVG or .PNG). Several parameters regarding the image size and resolution can be adjusted:

Argument Description
units “px”: pixels, “mm”: millimeters, “in”: inches
h height of the image in units.
w width of the image in units.
dpi dots per inches.

Note

If h and w values are both provided, image size will be adjusted even if it requires to break the original aspect ratio of the image. If only one value (h or w) is provided, the other will be estimated to maintain aspect ratio. If no sizing values are provided, image will be adjusted to A4 dimensions.

from ete3 import Tree
t = Tree( "((a,b),c);" )
t.render("mytree.png", w=183, units="mm")

Customizing the aspect of trees

Image customization is performed through four main elements:

Tree style

The TreeStyle class can be used to create a custom set of options that control the general aspect of the tree image. Tree styles can be passed to the TreeNode.show() and TreeNode.render() methods. For instance, TreeStyle allows to modify the scale used to render tree branches or choose between circular or rectangular tree drawing modes.

from ete3 import Tree, TreeStyle

t = Tree( "((a,b),c);" )
circular_style = TreeStyle()
circular_style.mode = "c" # draw tree in circular mode
circular_style.scale = 20
t.render("mytree.png", w=183, units="mm", tree_style=circular_style)

Warning

A number of parameters can be controlled through custom tree style objects, check TreeStyle documentation for a complete list of accepted values.

Some common uses include:

Show leaf node names, branch length and branch support

../_images/show_info.png

Automatically adds node names and branch information to the tree image:

from ete3 import Tree, TreeStyle
t = Tree()
t.populate(10, random_dist=True)
ts = TreeStyle()
ts.show_leaf_name = True
ts.show_branch_length = True
ts.show_branch_support = True
t.show(tree_style=ts)

Change branch length scale (zoom in X)

../_images/scale_x.png

Increases the length of the tree by changing the scale:

from ete3 import Tree, TreeStyle
t = Tree()
t.populate(10, random_dist=True)
ts = TreeStyle()
ts.show_leaf_name = True
ts.scale =  120 # 120 pixels per branch length unit
t.show(tree_style=ts)

Change branch separation between nodes (zoom in Y)

../_images/scale_y.png

Increases the separation between leaf branches:

from ete3 import Tree, TreeStyle
t = Tree()
t.populate(10, random_dist=True)
ts = TreeStyle()
ts.show_leaf_name = True
ts.branch_vertical_margin = 10 # 10 pixels between adjacent branches
t.show(tree_style=ts)

Rotate a tree

../_images/rotated_tree.png

Draws a rectangular tree from top to bottom:

from ete3 import Tree, TreeStyle
t = Tree()
t.populate(10)
ts = TreeStyle()
ts.show_leaf_name = True
ts.rotation = 90
t.show(tree_style=ts)

circular tree in 180 degrees

../_images/semi_circular_tree.png

Draws a circular tree using a semi-circumference:

from ete3 import Tree, TreeStyle
t = Tree()
t.populate(30)
ts = TreeStyle()
ts.show_leaf_name = True
ts.mode = "c"
ts.arc_start = -180 # 0 degrees = 3 o'clock
ts.arc_span = 180
t.show(tree_style=ts)

Add legend and title

from ete3 import Tree, TreeStyle, TextFace
t = Tree( "((a,b),c);" )
ts = TreeStyle()
ts.show_leaf_name = True
ts.title.add_face(TextFace("Hello ETE", fsize=20), column=0)
t.show(tree_style=ts)

Node style

Through the NodeStyle class the aspect of each single node can be controlled, including its size, color, background and branch type.

A node style can be defined statically and attached to several nodes:

../_images/node_style_red_nodes.png

Simple tree in which the same style is applied to all nodes:

from ete3 import Tree, NodeStyle, TreeStyle
t = Tree( "((a,b),c);" )

# Basic tree style
ts = TreeStyle()
ts.show_leaf_name = True

# Draws nodes as small red spheres of diameter equal to 10 pixels
nstyle = NodeStyle()
nstyle["shape"] = "sphere"
nstyle["size"] = 10
nstyle["fgcolor"] = "darkred"

# Gray dashed branch lines
nstyle["hz_line_type"] = 1
nstyle["hz_line_color"] = "#cccccc"

# Applies the same static style to all nodes in the tree. Note that,
# if "nstyle" is modified, changes will affect to all nodes
for n in t.traverse():
   n.set_style(nstyle)

t.show(tree_style=ts)

If you want to draw nodes with different styles, an independent NodeStyle instance must be created for each node. Note that node styles can be modified at any moment by accessing the TreeNode.img_style attribute.

../_images/node_style_red_and_blue_nodes.png

Simple tree in which the different styles are applied to each node:

from ete3 import Tree, NodeStyle, TreeStyle
t = Tree( "((a,b),c);" )

# Basic tree style
ts = TreeStyle()
ts.show_leaf_name = True

# Creates an independent node style for each node, which is
# initialized with a red foreground color.
for n in t.traverse():
   nstyle = NodeStyle()
   nstyle["fgcolor"] = "red"
   nstyle["size"] = 15
   n.set_style(nstyle)

# Let's now modify the aspect of the root node
t.img_style["size"] = 30
t.img_style["fgcolor"] = "blue"

t.show(tree_style=ts)

Static node styles, set through the set_style() method, will be attached to the nodes and exported as part of their information. For instance, TreeNode.copy() will replicate all node styles in the replicate tree. Note that node styles can be also modified on the fly through a layout function (see layout functions)

Node faces

Node faces are small pieces of graphical information that can be linked to nodes. For instance, text labels or external images could be linked to nodes and they will be plotted within the tree image.

Several types of node faces are provided by the main ete3 module, ranging from simple text (TextFace) and geometric shapes (CircleFace), to molecular sequence representations (SequenceFace), heatmaps and profile plots (ProfileFace). A complete list of available faces can be found at the ete3.treeview reference page..

Faces position

Faces can be added to different areas around the node, namely branch-right, branch-top, branch-bottom or aligned. Each area represents a table in which faces can be added through the TreeNode.add_face() method. For instance, if two text labels want to be drawn bellow the branch line of a given node, a pair of TextFace faces can be created and added to the columns 0 and 1 of the branch-bottom area:

from ete3 import Tree, TreeStyle, TextFace
t = Tree( "((a,b),c);" )

# Basic tree style
ts = TreeStyle()
ts.show_leaf_name = True

# Add two text faces to different columns
t.add_face(TextFace("hola "), column=0, position = "branch-right")
t.add_face(TextFace("mundo!"), column=1, position = "branch-right")
t.show(tree_style=ts)

If you add more than one face to the same area and column, they will be piled up. See the following image as an example of face positions:

possible face positions

Source code used to generate the above image.

Note

Once a face object is created, it can be linked to one or more nodes. For instance, the same text label can be recycled and added to several nodes.

Face properties

Apart from the specific config values of each face type, all face instances contain same basic attributes that permit to modify general aspects such as margins, background colors, border, etc. A complete list of face attributes can be found in the general Face class documentation. Here is a very simple example:

../_images/face_borders.png

Basic use of face general attributes

from ete3 import Tree, TreeStyle, TextFace

t = Tree( "(a,b);" )

# Basic tree style
ts = TreeStyle()
ts.show_leaf_name = True

# Creates two faces
hola = TextFace("hola")
mundo = TextFace("mundo")

# Set some attributes
hola.margin_top = 10
hola.margin_right = 10
hola.margin_left = 10
hola.margin_bottom = 10
hola.opacity = 0.5 # from 0 to 1
hola.inner_border.width = 1 # 1 pixel border
hola.inner_border.type = 1  # dashed line
hola.border.width = 1
hola.background.color = "LightGreen"

t.add_face(hola, column=0, position = "branch-top")
t.add_face(mundo, column=1, position = "branch-bottom")

t.show(tree_style=ts)

layout functions

Layout functions act as pre-drawing hooking functions. This means, when a node is about to be drawn, it is first sent to a layout function. Node properties, style and faces can be then modified on the fly and return it to the drawer engine. Thus, layout functions can be understood as a collection of rules controlling how different nodes should be drawn.

from ete3 import Tree
t = Tree( "((((a,b),c), d), e);" )

def abc_layout(node):
    vowels = set(["a", "e", "i", "o", "u"])
    if node.name in vowels:

       # Note that node style are already initialized with the
       # default values

       node.img_style["size"] = 15
       node.img_style["color"] = "red"

# Basic tree style
ts = TreeStyle()
ts.show_leaf_name = True

# Add two text faces to different columns
t.add_face(TextFace("hola "), column=0, position = "branch-right")
t.add_face(TextFace("mundo!"), column=1, position = "branch-right")
t.show(tree_style=ts)

Combining styles, faces and layouts

Examples are probably the best way to show how ETE works:

Fixed node styles

../_images/node_style.png
from ete3 import Tree, faces, AttrFace, TreeStyle, NodeStyle

def layout(node):
    # If node is a leaf, add the nodes name and a its scientific name
    if node.is_leaf():
        faces.add_face_to_node(AttrFace("name"), node, column=0)

def get_example_tree():

    t = Tree()
    t.populate(8)

    # Node style handling is no longer limited to layout functions. You
    # can now create fixed node styles and use them many times, save them
    # or even add them to nodes before drawing (this allows to save and
    # reproduce an tree image design)

    # Set bold red branch to the root node
    style = NodeStyle()
    style["fgcolor"] = "#0f0f0f"
    style["size"] = 0
    style["vt_line_color"] = "#ff0000"
    style["hz_line_color"] = "#ff0000"
    style["vt_line_width"] = 8
    style["hz_line_width"] = 8
    style["vt_line_type"] = 0 # 0 solid, 1 dashed, 2 dotted
    style["hz_line_type"] = 0
    t.set_style(style)

    #Set dotted red lines to the first two branches
    style1 = NodeStyle()
    style1["fgcolor"] = "#0f0f0f"
    style1["size"] = 0
    style1["vt_line_color"] = "#ff0000"
    style1["hz_line_color"] = "#ff0000"
    style1["vt_line_width"] = 2
    style1["hz_line_width"] = 2
    style1["vt_line_type"] = 2 # 0 solid, 1 dashed, 2 dotted
    style1["hz_line_type"] = 2
    t.children[0].img_style = style1
    t.children[1].img_style = style1

    # Set dashed blue lines in all leaves
    style2 = NodeStyle()
    style2["fgcolor"] = "#000000"
    style2["shape"] = "circle"
    style2["vt_line_color"] = "#0000aa"
    style2["hz_line_color"] = "#0000aa"
    style2["vt_line_width"] = 2
    style2["hz_line_width"] = 2
    style2["vt_line_type"] = 1 # 0 solid, 1 dashed, 2 dotted
    style2["hz_line_type"] = 1
    for l in t.iter_leaves():
        l.img_style = style2

    ts = TreeStyle()
    ts.layout_fn = layout
    ts.show_leaf_name = False

    return t, ts

if __name__ == "__main__":
    t, ts = get_example_tree()
    t.show(tree_style=ts)
    #t.render("node_style.png", w=400, tree_style=ts)

Node backgrounds

../_images/node_background.png
from ete3 import Tree, faces, AttrFace, TreeStyle, NodeStyle

def layout(node):
    if node.is_leaf():
        N = AttrFace("name", fsize=30)
        faces.add_face_to_node(N, node, 0, position="aligned")

def get_example_tree():

    # Set dashed blue lines in all leaves
    nst1 = NodeStyle()
    nst1["bgcolor"] = "LightSteelBlue"
    nst2 = NodeStyle()
    nst2["bgcolor"] = "Moccasin"
    nst3 = NodeStyle()
    nst3["bgcolor"] = "DarkSeaGreen"
    nst4 = NodeStyle()
    nst4["bgcolor"] = "Khaki"


    t = Tree("((((a1,a2),a3), ((b1,b2),(b3,b4))), ((c1,c2),c3));")
    for n in t.traverse():
        n.dist = 0

    n1 = t.get_common_ancestor("a1", "a2", "a3")
    n1.set_style(nst1)
    n2 = t.get_common_ancestor("b1", "b2", "b3", "b4")
    n2.set_style(nst2)
    n3 = t.get_common_ancestor("c1", "c2", "c3")
    n3.set_style(nst3)
    n4 = t.get_common_ancestor("b3", "b4")
    n4.set_style(nst4)
    ts = TreeStyle()
    ts.layout_fn = layout
    ts.show_leaf_name = False

    ts.mode = "c"
    ts.root_opening_factor = 1
    return t, ts

if __name__ == "__main__":
    t, ts = get_example_tree()
    #t.render("node_background.png", w=400, tree_style=ts)
    t.show(tree_style=ts)

Img Faces

../_images/img_faces.png

Note that images are attached to terminal and internal nodes.

# Import Tree instance and faces module
from ete3 import Tree, faces, TreeStyle

# Loads an example tree
nw = """
(((Dre:0.008339,Dme:0.300613)1.000000:0.596401,
(Cfa:0.640858,Hsa:0.753230)1.000000:0.182035)1.000000:0.106234,
((Dre:0.271621,Cfa:0.046042)1.000000:0.953250,
(Hsa:0.061813,Mms:0.110769)1.000000:0.204419)1.000000:0.973467);
"""
t = Tree(nw)

# You can create any random tree containing the same leaf names, and
# layout will work equally
#
# t = Tree()
# Creates a random tree with 8 leaves using a given set of names
# t.populate(8, ["Dme", "Dre", "Hsa", "Ptr", "Cfa", "Mms"])

# Set the path in which images are located
img_path = "./"
# Create faces based on external images
humanFace = faces.ImgFace(img_path+"human.png")
mouseFace = faces.ImgFace(img_path+"mouse.png")
dogFace = faces.ImgFace(img_path+"dog.png")
chimpFace = faces.ImgFace(img_path+"chimp.png")
fishFace = faces.ImgFace(img_path+"fish.png")
flyFace = faces.ImgFace(img_path+"fly.png")

# Create a faces ready to read the name attribute of nodes
#nameFace = faces.TextFace(open("text").readline().strip(), fsize=20, fgcolor="#009000")
nameFace = faces.AttrFace("name", fsize=20, fgcolor="#009000")

# Create a conversion between leaf names and real names
code2name = {
        "Dre":"Drosophila melanogaster",
        "Dme":"Danio rerio",
        "Hsa":"Homo sapiens",
        "Ptr":"Pan troglodytes",
        "Mms":"Mus musculus",
        "Cfa":"Canis familiaris"
        }

# Creates a dictionary with the descriptions of each leaf name
code2desc = {
        "Dre":"""The zebrafish, also known as Danio rerio,
is a tropical freshwater fish belonging to the
minnow family (Cyprinidae).""",
        "Dme":"""True flies are insects of the order Diptera,
possessing a single pair of wings on the
mesothorax and a pair of halteres, derived from
the hind wings, on the metathorax""",
        "Hsa":"""A human is a member of a species
of bipedal primates in the family Hominidae.""",
        "Ptr":"""Chimpanzee, sometimes colloquially
chimp, is the common name for the
two extant species of ape in the genus Pan.""",
        "Mms":"""A mouse is a small mammal belonging to the
order of rodents.""",
        "Cfa": """The dog (Canis lupus familiaris) is a
domesticated subspecies of the Gray Wolf,
a member of the Canidae family of the
orderCarnivora."""
        }

# Creates my own layout function. I will use all previously created
# faces and will set different node styles depending on the type of
# node.
def mylayout(node):
    # If node is a leaf, add the nodes name and a its scientific
    # name
    if node.is_leaf():
        # Add an static face that handles the node name
        faces.add_face_to_node(nameFace, node, column=0)
        # We can also create faces on the fly
        longNameFace = faces.TextFace(code2name[node.name])
        faces.add_face_to_node(longNameFace, node, column=0)

        # text faces support multiline. We add a text face
        # with the whole description of each leaf.
        descFace = faces.TextFace(code2desc[node.name], fsize=10)
        descFace.margin_top = 10
        descFace.margin_bottom = 10
        descFace.border.margin = 1

        # Note that this faces is added in "aligned" mode
        faces.add_face_to_node(descFace, node, column=0, aligned=True)

        # Sets the style of leaf nodes
        node.img_style["size"] = 12
        node.img_style["shape"] = "circle"
    #If node is an internal node
    else:
        # Sets the style of internal nodes
        node.img_style["size"] = 6
        node.img_style["shape"] = "circle"
        node.img_style["fgcolor"] = "#000000"

    # If an internal node contains more than 4 leaves, add the
    # images of the represented species sorted in columns of 2
    # images max.
    if len(node)>=4:
        col = 0
        for i, name in enumerate(set(node.get_leaf_names())):
            if i>0 and i%2 == 0:
                col += 1
            # Add the corresponding face to the node
            if name.startswith("Dme"):
                faces.add_face_to_node(flyFace, node, column=col)
            elif name.startswith("Dre"):
                faces.add_face_to_node(fishFace, node, column=col)
            elif name.startswith("Mms"):
                faces.add_face_to_node(mouseFace, node, column=col)
            elif name.startswith("Ptr"):
                faces.add_face_to_node(chimpFace, node, column=col)
            elif name.startswith("Hsa"):
                faces.add_face_to_node(humanFace, node, column=col)
            elif name.startswith("Cfa"):
                faces.add_face_to_node(dogFace, node, column=col)

            # Modifies this node's style
            node.img_style["size"] = 16
            node.img_style["shape"] = "sphere"
            node.img_style["fgcolor"] = "#AA0000"

    # If leaf is "Hsa" (homo sapiens), highlight it using a
    # different background.
    if node.is_leaf() and node.name.startswith("Hsa"):
        node.img_style["bgcolor"] = "#9db0cf"

# And, finally, Visualize the tree using my own layout function
ts = TreeStyle()
ts.layout_fn = mylayout
t.render("img_faces.png", w=600, tree_style = ts)

Bubble tree maps

../_images/bubble_map.png
import random
from ete3 import Tree, TreeStyle, NodeStyle, faces, AttrFace, CircleFace

def layout(node):
    if node.is_leaf():
        # Add node name to laef nodes
        N = AttrFace("name", fsize=14, fgcolor="black")
        faces.add_face_to_node(N, node, 0)
    if "weight" in node.features:
        # Creates a sphere face whose size is proportional to node's
        # feature "weight"
        C = CircleFace(radius=node.weight, color="RoyalBlue", style="sphere")
        # Let's make the sphere transparent
        C.opacity = 0.3
        # And place as a float face over the tree
        faces.add_face_to_node(C, node, 0, position="float")

def get_example_tree():
    # Random tree
    t = Tree()
    t.populate(20, random_branches=True)

    # Some random features in all nodes
    for n in t.traverse():
        n.add_features(weight=random.randint(0, 50))

    # Create an empty TreeStyle
    ts = TreeStyle()

    # Set our custom layout function
    ts.layout_fn = layout

    # Draw a tree
    ts.mode = "c"

    # We will add node names manually
    ts.show_leaf_name = False
    # Show branch data
    ts.show_branch_length = True
    ts.show_branch_support = True

    return t, ts

if __name__ == "__main__":
    t, ts = get_example_tree()

    #t.render("bubble_map.png", w=600, dpi=300, tree_style=ts)
    t.show(tree_style=ts)

Trees within trees

../_images/tree_faces.png
import random
from ete3 import Tree, TreeStyle, NodeStyle, faces, AttrFace, TreeFace

# Tree Style used to render small trees used as leaf faces
small_ts = TreeStyle()
small_ts.show_leaf_name = True
small_ts.scale = 10

def layout(node):
    if node.is_leaf():
        # Add node name to laef nodes
        N = AttrFace("name", fsize=14, fgcolor="black")
        faces.add_face_to_node(N, node, 0)

        t = Tree()
        t.populate(10)

        T = TreeFace(t, small_ts)
        # Let's make the sphere transparent
        T.opacity = 0.8
        # And place as a float face over the tree
        faces.add_face_to_node(T, node, 1, position="aligned")

def get_example_tree():
    # Random tree
    t = Tree()
    t.populate(20, random_branches=True)

    # Some random features in all nodes
    for n in t.traverse():
        n.add_features(weight=random.randint(0, 50))

    # Create an empty TreeStyle
    ts = TreeStyle()

    # Set our custom layout function
    ts.layout_fn = layout

    # Draw a tree
    ts.mode = "c"

    # We will add node names manually
    ts.show_leaf_name = False
    # Show branch data
    ts.show_branch_length = True
    ts.show_branch_support = True
    return t, ts

if __name__ == "__main__":
    t, ts = get_example_tree()
    #t.render("tree_faces.png", w=600, dpi=300, tree_style=ts)
    t.show(tree_style=ts)

Phylogenetic trees and sequence domains

../_images/seq_motif_faces.png
import sys
from ete3 import Tree, SeqMotifFace, TreeStyle, add_face_to_node

seq = ("-----------------------------------------------AQAK---IKGSKKAIKVFSSA---"
      "APERLQEYGSIFTDA---GLQRRPRHRIQSK-------ALQEKLKDFPVCVSTKPEPEDDAEEGLGGLPSN"
      "ISSVSSLLLFNTTENLYKKYVFLDPLAG----THVMLGAETEEKLFDAPLSISKREQLEQQVPENYFYVPD"
      "LGQVPEIDVPSYLPDLPGIANDLMYIADLGPGIAPSAPGTIPELPTFHTEVAEPLKVGELGSGMGAGPGTP"
      "AHTPSSLDTPHFVFQTYKMGAPPLPPSTAAPVGQGARQDDSSSSASPSVQGAPREVVDPSGGWATLLESIR"
      "QAGGIGKAKLRSMKERKLEKQQQKEQEQVRATSQGGHL--MSDLFNKLVMRRKGISGKGPGAGDGPGGAFA"
      "RVSDSIPPLPPPQQPQAEDED----")

mixed_motifs = [
        # seq.start, seq.end, shape, width, height, fgcolor, bgcolor
        [10, 100, "[]", None, 10, "black", "rgradient:blue", "arial|8|white|long text clipped long text clipped"],
        [101, 150, "o", None, 10, "blue", "pink", None],
        [155, 180, "()", None, 10, "blue", "rgradient:purple", None],
        [160, 190, "^", None, 14, "black", "yellow", None],
        [191, 200, "<>", None, 12, "black", "rgradient:orange", None],
        [201, 250, "o", None, 12, "black", "brown", None],
        [351, 370, "v", None, 15, "black", "rgradient:gold", None],
        [370, 420, "compactseq", 2, 10, None, None, None],
]

simple_motifs = [
        # seq.start, seq.end, shape, width, height, fgcolor, bgcolor
        [10, 60, "[]", None, 10, "black", "rgradient:blue", "arial|8|white|long text clipped long text clipped"],
        [120, 150, "o", None, 10, "blue", "pink", None],
        [200, 300, "()", None, 10, "blue", "red", "arial|8|white|hello"],
]

box_motifs = [
        # seq.start, seq.end, shape, width, height, fgcolor, bgcolor
        [0,  5, "[]", None, 10, "black", "rgradient:blue", "arial|8|white|10"],
        [10, 25, "[]", None, 10, "black", "rgradient:ref", "arial|8|white|10"],
        [30, 45, "[]", None, 10, "black", "rgradient:orange", "arial|8|white|20"],
        [50, 65, "[]", None, 10, "black", "rgradient:pink", "arial|8|white|20"],
        [70, 85, "[]", None, 10, "black", "rgradient:green", "arial|8|white|20"],
        [90, 105, "[]", None, 10, "black", "rgradient:brown", "arial|8|white|20"],
        [110, 125, "[]", None, 10, "black", "rgradient:yellow", "arial|8|white|20"],
]

def get_example_tree():
        # Create a random tree and add to each leaf a random set of motifs
        # from the original set
        t = Tree("( (A, B, C, D, E, F, G), H, I);")

        seqFace = SeqMotifFace(seq, gapcolor="red")
        (t & "A").add_face(seqFace, 0, "aligned")

        seqFace = SeqMotifFace(seq, seq_format="line", gap_format="blank")
        (t & "B").add_face(seqFace, 0, "aligned")

        seqFace = SeqMotifFace(seq, seq_format="line")
        (t & "C").add_face(seqFace, 0, "aligned")
        
        seqFace = SeqMotifFace(seq, seq_format="()")
        (t & "D").add_face(seqFace, 0, "aligned")

        seqFace = SeqMotifFace(seq, motifs=simple_motifs, seq_format="-")
        (t & "E").add_face(seqFace, 0, "aligned")

        seqFace = SeqMotifFace(seq=None, motifs=simple_motifs, gap_format="blank")
        (t & "F").add_face(seqFace, 0, "aligned")

        seqFace = SeqMotifFace(seq, motifs=mixed_motifs, seq_format="-")
        (t & "G").add_face(seqFace, 0, "aligned")

        
        seqFace = SeqMotifFace(seq=None, motifs=box_motifs, gap_format="line")
        (t & "H").add_face(seqFace, 0, "aligned")


        seqFace = SeqMotifFace(seq[30:60], seq_format="seq")
        (t & "I").add_face(seqFace, 0, "aligned")
        
        return t
        
if __name__ == '__main__':
    t = get_example_tree()
    ts = TreeStyle()
    ts.tree_width = 50
    #t.show(tree_style=ts)
    t.render("seq_motif_faces.png", tree_style=ts)

Creating your custom interactive Item faces

../_images/item_faces.png

Note that item faces shown in this image are not static. When the tree is view using the tree.show() method, you can interact with items.

# We will need to create Qt4 items
from PyQt4 import QtCore
from PyQt4.QtGui import QGraphicsRectItem, QGraphicsSimpleTextItem, \
    QGraphicsEllipseItem, QColor, QPen, QBrush

from ete3 import Tree, faces, TreeStyle, NodeStyle

# To play with random colors
import colorsys
import random

class InteractiveItem(QGraphicsRectItem):
    def __init__(self, *arg, **karg):
        QGraphicsRectItem.__init__(self, *arg, **karg)
        self.node = None
        self.label = None
        self.setCursor(QtCore.Qt.PointingHandCursor)
        self.setAcceptsHoverEvents(True)

    def hoverEnterEvent (self, e):
        # There are many ways of adding interactive elements. With the
        # following code, I show/hide a text item over my custom
        # DynamicItemFace
        if not self.label:
            self.label = QGraphicsRectItem()
            self.label.setParentItem(self)
            # This is to ensure that the label is rendered over the
            # rest of item children (default ZValue for items is 0)
            self.label.setZValue(1)
            self.label.setBrush(QBrush(QColor("white")))
            self.label.text = QGraphicsSimpleTextItem()
            self.label.text.setParentItem(self.label)

        self.label.text.setText(self.node.name)
        self.label.setRect(self.label.text.boundingRect())
        self.label.setVisible(True)

    def hoverLeaveEvent(self, e):
        if self.label:
            self.label.setVisible(False)

def random_color(h=None):
    """Generates a random color in RGB format."""
    if not h:
        h = random.random()
    s = 0.5
    l = 0.5
    return _hls2hex(h, l, s)

def _hls2hex(h, l, s):
    return '#%02x%02x%02x' %tuple(map(lambda x: int(x*255),
                                      colorsys.hls_to_rgb(h, l, s)))

def ugly_name_face(node, *args, **kargs):
    """ This is my item generator. It must receive a node object, and
    returns a Qt4 graphics item that can be used as a node face.
    """

    # receive an arbitrary number of arguments, in this case width and
    # height of the faces
    width = args[0][0]
    height = args[0][1]

    ## Creates a main master Item that will contain all other elements
    ## Items can be standard QGraphicsItem
    # masterItem = QGraphicsRectItem(0, 0, width, height)

    # Or your custom Items, in which you can re-implement interactive
    # functions, etc. Check QGraphicsItem doc for details.
    masterItem = InteractiveItem(0, 0, width, height)

    # Keep a link within the item to access node info
    masterItem.node = node

    # I dont want a border around the masterItem
    masterItem.setPen(QPen(QtCore.Qt.NoPen))

    # Add ellipse around text
    ellipse = QGraphicsEllipseItem(masterItem.rect())
    ellipse.setParentItem(masterItem)
    # Change ellipse color
    ellipse.setBrush(QBrush(QColor( random_color())))

    # Add node name within the ellipse
    text = QGraphicsSimpleTextItem(node.name)
    text.setParentItem(ellipse)
    text.setPen(QPen(QPen(QColor("white"))))

    # Center text according to masterItem size
    tw = text.boundingRect().width()
    th = text.boundingRect().height()
    center = masterItem.boundingRect().center()
    text.setPos(center.x()-tw/2, center.y()-th/2)

    return masterItem

def master_ly(node):
    if node.is_leaf():
        # Create an ItemFAce. First argument must be the pointer to
        # the constructor function that returns a QGraphicsItem. It
        # will be used to draw the Face. Next arguments are arbitrary,
        # and they will be forwarded to the constructor Face function.
        F = faces.DynamicItemFace(ugly_name_face, 100, 50)
        faces.add_face_to_node(F, node, 0, position="aligned")

def get_example_tree():

    t = Tree()
    t.populate(8, reuse_names=False)

    ts = TreeStyle()
    ts.layout_fn = master_ly
    ts.title.add_face(faces.TextFace("Drawing your own Qt Faces", fsize=15), 0)
    return t, ts

if __name__ == "__main__":
    t, ts = get_example_tree()

    #t.render("item_faces.png", h=400, tree_style=ts)
    # The interactive features are only available using the GUI
    t.show(tree_style=ts)